Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8-S100A9 Heterodimer, Human (His, solution)

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His, solution) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A8-S100A9 Heterodimer Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-a9-heterodimer-protein-human-his.html

Purity

98.0

Smiles

A1:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEA2:TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6279&6280 (Gene_ID) P05109 (M1-E93) (S100A8) &P06702 (T2-P114) (S100A9) (Accession)

Molecular Weight

Approximately 13 kDa & 15-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Silver Sulfate
TRC-S465060-5G 5 g

Silver Sulfate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS624411 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
LRRC55 Human Gene Knockout Kit (CRISPR)
KN421563 1 Kit

LRRC55 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703619 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Diethyl Adipate-d10
TRC-D455407-10MG 10 mg

Diethyl Adipate-d10

Sign In for Pricing
View Details
LYN Antibody
KC-15261-01 50 μL

LYN Antibody

Sign In for Pricing
View Details