Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8-S100A9 Heterodimer, Human (His, solution)

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His, solution) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A8-S100A9 Heterodimer Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-a9-heterodimer-protein-human-his.html

Purity

98.0

Smiles

A1:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEA2:TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6279&6280 (Gene_ID) P05109 (M1-E93) (S100A8) &P06702 (T2-P114) (S100A9) (Accession)

Molecular Weight

Approximately 13 kDa & 15-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEET ω-Carboxylic Acid
TRC-D228505-50MG 50 mg

DEET ω-Carboxylic Acid

Sign In for Pricing
View Details
SLC35A5 Rabbit Polyclonal Antibody
TA361818 100 µL

SLC35A5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SREBP1 (SREBP1/1578), CF640R conjugate, 0.1mg/mL
BNC401578-100 1x 100 µL

SREBP1 (SREBP1/1578), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAPX1 (NKX3-2) (NM_001189) Human Recombinant Protein
TP311285L 1 mg

BAPX1 (NKX3-2) (NM_001189) Human Recombinant Protein

Sign In for Pricing
View Details
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), Biotin conjugate, 0.1mg/mL
BNCB2231-500 1x 500 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NQO2 Human Gene Knockout Kit (CRISPR)
KN202889 1 Kit

NQO2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details