Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphB1, Human (sf9, His-GST)

The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Product Specifications

Product Name Alternative

EphB1 Protein, Human (sf9, His-GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephb1-protein-human-sf9-his-gst.html

Smiles

RKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMA

Molecular Formula

2047 (Gene_ID) AAI11745.1 (R565-A984) (Accession)

Molecular Weight

Approximately 66 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC177 Human Gene Knockout Kit (CRISPR)
KN434752 1 Kit

CCDC177 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(+)-N-Acetyl 3,4,4a,5,6,10b-Hexahydro-2H-naphtho[1,2-b][1,4]oxazine-9-ol Triisopropylsilyl Ether
TRC-A178275-2MG 2 mg

(+)-N-Acetyl 3,4,4a,5,6,10b-Hexahydro-2H-naphtho[1,2-b][1,4]oxazine-9-ol Triisopropylsilyl Ether

Sign In for Pricing
View Details
Mouse IL-33 Recombinant Rabbit Monoclonal Antibody [PSH08-41] - BSA and Azide free (Capture)
HA722985 100 µL

Mouse IL-33 Recombinant Rabbit Monoclonal Antibody [PSH08-41] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
CASP5 (p20, Cleaved-Asp121) Antibody
8L0158-AAT 50 µg

CASP5 (p20, Cleaved-Asp121) Antibody

Sign In for Pricing
View Details
(1S,2S)-1,2-Cyclopropanedicarboxylic Acid 1,2-Diethyl Ester
TRC-C990413-5G 5 g

(1S,2S)-1,2-Cyclopropanedicarboxylic Acid 1,2-Diethyl Ester

Sign In for Pricing
View Details
Sodium 2-((2-Aminoethyl)amino)ethanesulfonate (50% in Water)
TRC-S612005-50G 50 g

Sodium 2-((2-Aminoethyl)amino)ethanesulfonate (50% in Water)

Sign In for Pricing
View Details