Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphB1, Human (sf9, His-GST)

The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Product Specifications

Product Name Alternative

EphB1 Protein, Human (sf9, His-GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephb1-protein-human-sf9-his-gst.html

Smiles

RKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMA

Molecular Formula

2047 (Gene_ID) AAI11745.1 (R565-A984) (Accession)

Molecular Weight

Approximately 66 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Rabbit Polyclonal Antibody
AP06445PU-N 100 µg

CD40 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Mouse Monoclonal Antibody [Clone ID: OTI10B5]
CF812362 100 µg

CD27 Mouse Monoclonal Antibody [Clone ID: OTI10B5]

Sign In for Pricing
View Details
GPR34 (Center) Rabbit Polyclonal Antibody
AP51926PU-N 400 µL

GPR34 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Bromo-4-chloro-6-nitroanisole
TRC-B682518-50MG 50 mg

2-Bromo-4-chloro-6-nitroanisole

Sign In for Pricing
View Details
Uncoated Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit
E-UNEL-M0008-01 5x 96 Tests

Uncoated Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit
E-UNEL-M0008-02 15x 96 Tests

Uncoated Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details