Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-AA, Rat (P.pastoris, His)

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PDGF-AA Protein, Rat (P.pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-a-protein-rat-p-pastoris-his.html

Purity

90.0

Smiles

RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK

Molecular Formula

25266 (Gene_ID) P28576-1 (R86-K204) (Accession)

Molecular Weight

Approximately 17-22 kDa & 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OR4F17 (N-term) Rabbit Polyclonal Antibody
AP53053PU-N 400 µL

OR4F17 (N-term) Rabbit Polyclonal Antibody

Ask
View Details
Trafd1 (NM_053760) Rat Tagged Lenti ORF Clone
RR208398L4 10 µg

Trafd1 (NM_053760) Rat Tagged Lenti ORF Clone

Ask
View Details
Rabbit Monoclonal Mesothelin Antibody (MSLN/8391R) [Alexa Fluor 532]
NBP3-20894AF532 0.1 mL

Rabbit Monoclonal Mesothelin Antibody (MSLN/8391R) [Alexa Fluor 532]

Ask
View Details
Mouse ETS-Related Transcription Factor ELF-4 (ELF4) ELISA Kit
MBS9936583-01 48 Well

Mouse ETS-Related Transcription Factor ELF-4 (ELF4) ELISA Kit

Ask
View Details
Mouse ETS-Related Transcription Factor ELF-4 (ELF4) ELISA Kit
MBS9936583-02 96 Well

Mouse ETS-Related Transcription Factor ELF-4 (ELF4) ELISA Kit

Ask
View Details
Mouse ETS-Related Transcription Factor ELF-4 (ELF4) ELISA Kit
MBS9936583-03 5x 96 Well

Mouse ETS-Related Transcription Factor ELF-4 (ELF4) ELISA Kit

Ask
View Details