Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-AA, Rat (P.pastoris, His)

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PDGF-AA Protein, Rat (P.pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-a-protein-rat-p-pastoris-his.html

Purity

90.0

Smiles

RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK

Molecular Formula

25266 (Gene_ID) P28576-1 (R86-K204) (Accession)

Molecular Weight

Approximately 17-22 kDa & 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Annexin A1 Antibody (ANXA1/3566) [mFluor Violet 450 SE]
NBP3-08708MFV450 0.1 mL

Mouse Monoclonal Annexin A1 Antibody (ANXA1/3566) [mFluor Violet 450 SE]

Ask
View Details
Rabbit Polyclonal CLCA1 Antibody [CoraFluor 1]
NBP2-99573CL1 0.1 mL

Rabbit Polyclonal CLCA1 Antibody [CoraFluor 1]

Ask
View Details
TSPAN14 Antibody, FITC conjugated
A64596-50UG 50 µg

TSPAN14 Antibody, FITC conjugated

Ask
View Details