Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-AA, Rat (P.pastoris, His)

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PDGF-AA Protein, Rat (P.pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-a-protein-rat-p-pastoris-his.html

Purity

90.0

Smiles

RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK

Molecular Formula

25266 (Gene_ID) P28576-1 (R86-K204) (Accession)

Molecular Weight

Approximately 17-22 kDa & 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human PTH7-84, 15N
P6987-500μg 500 µg

Recombinant Human PTH7-84, 15N

Ask
View Details
Lentiviral human ACOT9 shRNA (UAS) - Lentiviral human ACOT9 shRNA (UAS) (100)
GTR15136818 1 Vial

Lentiviral human ACOT9 shRNA (UAS) - Lentiviral human ACOT9 shRNA (UAS) (100)

Ask
View Details
Lentiviral mouse Mthfsl shRNA (UAS) - Lentiviral mouse Mthfsl shRNA (UAS, RFP) plasmid
GTR15273205 1 Vial

Lentiviral mouse Mthfsl shRNA (UAS) - Lentiviral mouse Mthfsl shRNA (UAS, RFP) plasmid

Ask
View Details
Tuba1a (NM_022298) Rat Tagged ORF Clone Lentiviral Particle
RR202095L3V 200 µL

Tuba1a (NM_022298) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Rabbit Polyclonal VKORC1 Antibody [Alexa Fluor 405]
NBP2-81859AF405 0.1 mL

Rabbit Polyclonal VKORC1 Antibody [Alexa Fluor 405]

Ask
View Details