Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-AA, Rat (P.pastoris, His)

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PDGF-AA Protein, Rat (P.pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-a-protein-rat-p-pastoris-his.html

Purity

90.0

Smiles

RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK

Molecular Formula

25266 (Gene_ID) P28576-1 (R86-K204) (Accession)

Molecular Weight

Approximately 17-22 kDa & 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CD90/Thy1 Antibody (OX-7) [Janelia Fluor 669]
NB100-65543JF669 0.25 mL

Mouse Monoclonal CD90/Thy1 Antibody (OX-7) [Janelia Fluor 669]

Ask
View Details
T-box Transcription Factor TBX6 (TBX6) Human ELISA Kit
H4263 96 Tests

T-box Transcription Factor TBX6 (TBX6) Human ELISA Kit

Ask
View Details
Human LOC346329 qPCR Primer Pair
QH73861S 200 Tests

Human LOC346329 qPCR Primer Pair

Ask
View Details
Nectin 3 Protein, Human, Recombinant (His Tag)
MBS8120524-01 0.1 mg

Nectin 3 Protein, Human, Recombinant (His Tag)

Ask
View Details
Nectin 3 Protein, Human, Recombinant (His Tag)
MBS8120524-02 1 mg

Nectin 3 Protein, Human, Recombinant (His Tag)

Ask
View Details
Nectin 3 Protein, Human, Recombinant (His Tag)
MBS8120524-03 5x 1 mg

Nectin 3 Protein, Human, Recombinant (His Tag)

Ask
View Details