PDGF-AA, Rat (P.pastoris, His)
PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
PDGF-AA Protein, Rat (P.pastoris, His), Rat, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-a-protein-rat-p-pastoris-his.html
Purity
90.0
Smiles
RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK
Molecular Formula
25266 (Gene_ID) P28576-1 (R86-K204) (Accession)
Molecular Weight
Approximately 17-22 kDa & 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
HAVCR2, ID (HAVCR2, TIM3, TIMD3, Hepatitis A virus cellular receptor 2, T-cell immunoglobulin and mucin domain-containing protein 3, T-cell membrane protein 3, TIM-3) (MaxLight 650) discontinued
CPT1A, CT (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) (MaxLight 490) discontinued
