Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-AA, Rat (P.pastoris, His)

PDGF-AA protein is a key growth factor that serves as an effective mitogen for mesenchymal cells, coordinates embryonic development, and affects cell proliferation, migration, survival, and chemotaxis. It plays an important role in alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, oligodendrocyte development, and myelination of the spinal cord and cerebellum. PDGF-AA Protein, Rat (P.pastoris, His) is the recombinant rat-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PDGF-AA Protein, Rat (P.pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-a-protein-rat-p-pastoris-his.html

Purity

90.0

Smiles

RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRK

Molecular Formula

25266 (Gene_ID) P28576-1 (R86-K204) (Accession)

Molecular Weight

Approximately 17-22 kDa & 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SLC25A22 (NM_024698) Human Tagged Lenti ORF Clone
RC203650L3 10 µg

SLC25A22 (NM_024698) Human Tagged Lenti ORF Clone

Ask
View Details
Rabbit Polyclonal BTBD9 Antibody [DyLight 594]
NBP3-05962DL594 0.1 mL

Rabbit Polyclonal BTBD9 Antibody [DyLight 594]

Ask
View Details
Human TRIM22 shRNA Plasmid
abx957013-01 150 µg

Human TRIM22 shRNA Plasmid

Ask
View Details
Human TRIM22 shRNA Plasmid
abx957013-02 300 µg

Human TRIM22 shRNA Plasmid

Ask
View Details
Rabbit Monoclonal Serum Amyloid A4 Antibody (014) [Janelia Fluor 549]
NBP2-89368JF549 0.1 mL

Rabbit Monoclonal Serum Amyloid A4 Antibody (014) [Janelia Fluor 549]

Ask
View Details
Pig Superoxide Dismutase 1, Active Protein
RPU60504-01 50 µg

Pig Superoxide Dismutase 1, Active Protein

Ask
View Details