Recombinant Chlorobium phaeobacteroides 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Product Specifications

CAS Number

9000-83-3

Gene Name

[aroA]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[aroA; EPSP synthase; EPSPS]

Short Name

[3-phosphoshikimate 1-carboxyvinyltransferase (aroA)]

Other Product Names

[3-phosphoshikimate 1-carboxyvinyltransferase; 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase]

NCBI GI Number

501452095

NCBI Accession Number

WP_012475544.1

NCBI GB Accession Number

WP_012475544.1

Uniprot Accession Number

B3ENJ1

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRC-K570200-100MG 100 mg

Kinsenoside

View Details

RC220659L2V 200 µL

alpha 2b Adrenergic Receptor (ADRA2B) (NM_000682) Human Tagged ORF Clone Lentiviral Particle

View Details

PV216719 500 ng

PLA2G4C Protein Vector (Mouse) (pPB-N-His)

View Details

MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

View Details

SI010760A 1 Each

Human NPTXR Pre-designed siRNA Set A

View Details

bs-8664R-APC-Cy5.5 100 µL

Phospho-ZIP Kinase (Thr265) Polyclonal Antibody, APC-Cy5.5 Conjugated

View Details