Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Canine

IL-3 Protein, Canine is a hemopoietic growth factor involved in the survival, proliferation and differentiation of multipotent hemopoietic cells.

Product Specifications

Product Name Alternative

IL-3 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-canine.html

Purity

97.0

Smiles

RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP

Molecular Formula

481497 (Gene_ID) Q9BDX4 (R24-P143) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Mangi MH, et al. Interleukin-3 in hematology and oncology: current state of knowledge and future directions. Cytokines Cell Mol Ther. 1999 Jun;5 (2) :87-95.|[2]Morris CF, et al. Molecular and cellular biology of interleukin-3. Immunol Ser. 1990;49:177-214.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon
CR562005 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
TRIM61 (NM_001012414) Human Recombinant Protein
TP761647 50 µg

TRIM61 (NM_001012414) Human Recombinant Protein

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COG8 (NM_032382) Human Recombinant Protein
TP319727M 100 µg

COG8 (NM_032382) Human Recombinant Protein

Sign In for Pricing
View Details
(Z-LLE) 2R110
13466-AAT 1 mg

(Z-LLE) 2R110

Sign In for Pricing
View Details
ITGB1BP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E1]
TA803814BM 100 µL

ITGB1BP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E1]

Sign In for Pricing
View Details