Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Canine

IL-3 Protein, Canine is a hemopoietic growth factor involved in the survival, proliferation and differentiation of multipotent hemopoietic cells.

Product Specifications

Product Name Alternative

IL-3 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-canine.html

Purity

97.0

Smiles

RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP

Molecular Formula

481497 (Gene_ID) Q9BDX4 (R24-P143) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Mangi MH, et al. Interleukin-3 in hematology and oncology: current state of knowledge and future directions. Cytokines Cell Mol Ther. 1999 Jun;5 (2) :87-95.|[2]Morris CF, et al. Molecular and cellular biology of interleukin-3. Immunol Ser. 1990;49:177-214.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUV39H1 (N-term) Rabbit Polyclonal Antibody
AP11169PU-N 400 µL

SUV39H1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mebroqualone
TRC-M202545-10MG 10 mg

Mebroqualone

Sign In for Pricing
View Details
FUT7 Human Gene Knockout Kit (CRISPR)
KN416316 1 Kit

FUT7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD33 Antibody[6C5]
E-AB-F1083Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD33 Antibody[6C5]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD33 Antibody[6C5]
E-AB-F1083Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD33 Antibody[6C5]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD33 Antibody[6C5]
E-AB-F1083Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Human CD33 Antibody[6C5]

Sign In for Pricing
View Details