Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Canine

IL-3 Protein, Canine is a hemopoietic growth factor involved in the survival, proliferation and differentiation of multipotent hemopoietic cells.

Product Specifications

Product Name Alternative

IL-3 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-canine.html

Purity

97.0

Smiles

RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP

Molecular Formula

481497 (Gene_ID) Q9BDX4 (R24-P143) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Mangi MH, et al. Interleukin-3 in hematology and oncology: current state of knowledge and future directions. Cytokines Cell Mol Ther. 1999 Jun;5 (2) :87-95.|[2]Morris CF, et al. Molecular and cellular biology of interleukin-3. Immunol Ser. 1990;49:177-214.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM Maxi CF®594 Antibody Labeling Kit, 1x1mg labeling
#92408 1 Kit

Mix-n-StainTM Maxi CF®594 Antibody Labeling Kit, 1x1mg labeling

Sign In for Pricing
View Details
CMTM6 Polyclonal Antibody
E-AB-12450-01 20 µL

CMTM6 Polyclonal Antibody

Sign In for Pricing
View Details
CMTM6 Polyclonal Antibody
E-AB-12450-02 60 µL

CMTM6 Polyclonal Antibody

Sign In for Pricing
View Details
CMTM6 Polyclonal Antibody
E-AB-12450-03 120 µL

CMTM6 Polyclonal Antibody

Sign In for Pricing
View Details
CMTM6 Polyclonal Antibody
E-AB-12450-04 200 µL

CMTM6 Polyclonal Antibody

Sign In for Pricing
View Details
GF-1 Plasmid Starter Kit / Chromo Taq DNA Polymerase, 25 preps
GF-PL-KW 25 Preparations

GF-1 Plasmid Starter Kit / Chromo Taq DNA Polymerase, 25 preps

Sign In for Pricing
View Details