Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Bovine (P. pastoris, His-Myc)

The GM-CSF protein is a key cytokine that fundamentally stimulates the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. As a monomer, GM-CSF interacts with the GM-CSF receptor complex to form a dodecamer, which contains two α, two β, and two head-to-head hexamers of the ligand subunits. GM-CSF Protein, Bovine (P. pastoris, His-Myc) is the recombinant bovine-derived GM-CSF protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.

Product Specifications

Product Name Alternative

GM-CSF Protein, Bovine (P. pastoris, His-Myc), Bovine, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf2-protein-bovine-p-pastoris-his-myc.html

Purity

90.00

Smiles

APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK

Molecular Formula

281095 (Gene_ID) P11052 (A18-K143) (Accession)

Molecular Weight

Approximately 21-24 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog