Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C2, Human (His)

AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

AKR1C2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akr1c2-protein-human-his.html

Purity

93.00

Smiles

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Molecular Formula

1646 (Gene_ID) P52895 (M1-Y323) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY5 Human Gene Knockout Kit (CRISPR)
KN422906 1 Kit

ADCY5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MOK protein kinase (MOK) (Center) Rabbit Polyclonal Antibody
AP17699PU-N 400 µL

MOK protein kinase (MOK) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Clmp Mouse Gene Knockout Kit (CRISPR)
KN503474 1 Kit

Clmp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Rat IgG,
AA-2362-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Rat IgG,

Sign In for Pricing
View Details
Ccdc125 Mouse Gene Knockout Kit (CRISPR)
KN502648 1 Kit

Ccdc125 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Ferritin Heavy Chain Antibody
RC-4140-01 50 μL

Recombinant Ferritin Heavy Chain Antibody

Sign In for Pricing
View Details