Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C2, Human (His)

AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

AKR1C2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akr1c2-protein-human-his.html

Purity

93.00

Smiles

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Molecular Formula

1646 (Gene_ID) P52895 (M1-Y323) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptophysin (SYP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]
TA506067BM 100 µL

Synaptophysin (SYP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
PIK-75
TRC-P437670-5MG 5 mg

PIK-75

Sign In for Pricing
View Details
Recombinant SLC25A12 Monoclonal Antibody
AN301939L-01 50 µL

Recombinant SLC25A12 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SLC25A12 Monoclonal Antibody
AN301939L-02 100 µL

Recombinant SLC25A12 Monoclonal Antibody

Sign In for Pricing
View Details
Grem1 Rabbit Polyclonal Antibody
AP26029PU-N 100 µg

Grem1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAX7 (PAX7/497), Biotin conjugate, 0.1mg/mL
BNCB0497-100 1x 100 µL

PAX7 (PAX7/497), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details