Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C2, Human (His)

AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

AKR1C2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akr1c2-protein-human-his.html

Purity

93.00

Smiles

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Molecular Formula

1646 (Gene_ID) P52895 (M1-Y323) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ldhb Rabbit Polyclonal Antibody
TA363042 100 µL

Ldhb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PBX1 Recombinant Rabbit Monoclonal Antibody [PSH0-24]
HA721303 100 µL

PBX1 Recombinant Rabbit Monoclonal Antibody [PSH0-24]

Sign In for Pricing
View Details
2,2-Difluoro-2-(thiophen-2-yl)ethan-1-amine
TRC-D206081-1G 1 g

2,2-Difluoro-2-(thiophen-2-yl)ethan-1-amine

Sign In for Pricing
View Details
Eph receptor B6 (EPHB6) Rabbit Polyclonal Antibody
AP20511PU-N 100 µg

Eph receptor B6 (EPHB6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human OC Antibody Pair Set
E-KAB-0192 50 µL & 100 µg

Human OC Antibody Pair Set

Sign In for Pricing
View Details
FSH beta (FSHB) (NM_000510) Human Recombinant Protein
TP322666 20 µg

FSH beta (FSHB) (NM_000510) Human Recombinant Protein

Sign In for Pricing
View Details