Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C2, Human (His)

AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

AKR1C2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akr1c2-protein-human-his.html

Purity

93.00

Smiles

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Molecular Formula

1646 (Gene_ID) P52895 (M1-Y323) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf72 Protein Vector (Human) (pPM-C-HA)
13781021 500 ng

C12orf72 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Interleukin 1 Beta (IL1b) Magnetic Luminex Assay Kit
LKU604161 96 Tests

Interleukin 1 Beta (IL1b) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
PCCB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV639272 1.0 µg DNA

PCCB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ARL5 Antibody Blocking peptide
orb1450948 500 µg

ARL5 Antibody Blocking peptide

Sign In for Pricing
View Details
Anti- Apolipoprotein C-I (APO C-I) Antibody
GWB-DAF7AD 1 mg

Anti- Apolipoprotein C-I (APO C-I) Antibody

Sign In for Pricing
View Details
IGHG1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV711222 1.0 µg DNA

IGHG1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details