Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3R alpha/CD123, Human (HEK293, His)

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (HEK293, His) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3R alpha/CD123 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3r-alpha-cd123-protein-human-hek-293-his.html

Purity

98.0

Smiles

TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Molecular Formula

3563 (Gene_ID) P26951-1 (T19-R305) (Accession)

Molecular Weight

Approximately 40-72 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Map2k3os activation kit by CRISPRa
GA204891 1 Kit

Mouse Map2k3os activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-WFS1 antibody
PAab09509 100 µg

Anti-WFS1 antibody

Sign In for Pricing
View Details
E4BP4/NFIL3 Rabbit mAb
C05770-100uL 100 µL

E4BP4/NFIL3 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Leptospira Biflexa argE Protein (aa 1-277)
VAng-Wyb0009-50gEcoli 50 µg (E. coli)

Recombinant Leptospira Biflexa argE Protein (aa 1-277)

Sign In for Pricing
View Details
Rabbit Polyclonal TIMMDC1 Antibody [DyLight 594]
NBP3-26071DL594 0.1 mL

Rabbit Polyclonal TIMMDC1 Antibody [DyLight 594]

Sign In for Pricing
View Details
NELL1 3'UTR Lenti-reporter-Luc Vector
31718081 1.0 µg

NELL1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details