Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIC, Human (Trx-His)

PPIC protein is a peptidyl-prolyl cis-trans isomerase (PPIase) that actively catalyzes the cis-trans isomerization of prolyl imide peptide bonds, which is a key step in protein folding. Its role in promoting conformational changes ensures correct folding and maturation of proteins, contributing to cellular proteostasis. PPIC Protein, Human (Trx-His) is the recombinant human-derived PPIC protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PPIC Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppic-protein-human-trx-his.html

Purity

97.00

Smiles

KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD

Molecular Formula

5480 (Gene_ID) P45877 (K31-D182) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TIM-1, ID (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) discontinued. see T5469-91D
T5469-91L 50 µg

TIM-1, ID (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) discontinued. see T5469-91D

Ask
View Details
Xpress™ Human MRAS Over-expressing Stable Cell Line
ABC-X1915 1 Vial

Xpress™ Human MRAS Over-expressing Stable Cell Line

Ask
View Details
VMAT1 (SLC18A1) (NM_003053) Human Tagged Lenti ORF Clone
RC221148L4 10 µg

VMAT1 (SLC18A1) (NM_003053) Human Tagged Lenti ORF Clone

Ask
View Details
FRMD3 (NM_174938) Human Tagged ORF Clone Lentiviral Particle
RC219021L3V 200 µL

FRMD3 (NM_174938) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human NudC Domain Containing 3 (NUDCD3) ELISA Kit
abx381910 96 Tests

Human NudC Domain Containing 3 (NUDCD3) ELISA Kit

Ask
View Details