Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIC, Human (Trx-His)

PPIC protein is a peptidyl-prolyl cis-trans isomerase (PPIase) that actively catalyzes the cis-trans isomerization of prolyl imide peptide bonds, which is a key step in protein folding. Its role in promoting conformational changes ensures correct folding and maturation of proteins, contributing to cellular proteostasis. PPIC Protein, Human (Trx-His) is the recombinant human-derived PPIC protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PPIC Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppic-protein-human-trx-his.html

Purity

97.00

Smiles

KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD

Molecular Formula

5480 (Gene_ID) P45877 (K31-D182) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (PE)
MBS6157256-01 0.1 mL

CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (PE)

Ask
View Details
CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (PE)
MBS6157256-02 5x 0.1 mL

CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (PE)

Ask
View Details
SP110 (NM_001185015) Human Over-expression Lysate
LC433264 20 µg

SP110 (NM_001185015) Human Over-expression Lysate

Ask
View Details
Human AS3MT Protein Lysate
MBS137596-01 0.02 mg

Human AS3MT Protein Lysate

Ask
View Details
Human AS3MT Protein Lysate
MBS137596-02 5x 0.02 mg

Human AS3MT Protein Lysate

Ask
View Details
Adipogenic Differentiation Medium for Human Adipose-Derived Mesenchymal Stem Cells
abx705191 400 mL

Adipogenic Differentiation Medium for Human Adipose-Derived Mesenchymal Stem Cells

Ask
View Details