Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIC, Human (Trx-His)

PPIC protein is a peptidyl-prolyl cis-trans isomerase (PPIase) that actively catalyzes the cis-trans isomerization of prolyl imide peptide bonds, which is a key step in protein folding. Its role in promoting conformational changes ensures correct folding and maturation of proteins, contributing to cellular proteostasis. PPIC Protein, Human (Trx-His) is the recombinant human-derived PPIC protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PPIC Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppic-protein-human-trx-his.html

Purity

97.00

Smiles

KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD

Molecular Formula

5480 (Gene_ID) P45877 (K31-D182) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF568 conjugate, 0.1mg/mL
BNC682145-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF647 conjugate, 0.1mg/mL
BNC470950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 (LFA2/600), CF740 conjugate, 0.1mg/mL
BNC740600-500 1x 500 µL

CD2 (LFA2/600), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), CF640R conjugate, 0.1mg/mL
BNC401082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details