Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IP-10/CXCL10, Human (HEK293, His-Myc)

The IP-10/CXCL10 protein is a pro-inflammatory cytokine involved in a variety of biological processes, including chemotaxis, immune cell activation, growth regulation, apoptosis, and vasostatic regulation. During viral infection, IP-10 crucially stimulates immune cell activation and migration to the site of infection. IP-10/CXCL10 Protein, Human (HEK293, His-Myc) is the recombinant human-derived IP-10/CRG-2/CXCL10 protein, expressed by HEK293 , with N-Myc, N-6*His labeled tag.

Product Specifications

Product Name Alternative

IP-10/CXCL10 Protein, Human (HEK293, His-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ip-10-crg-2-cxcl10-protein-human-hek293-his-myc.html

Purity

95.00

Smiles

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Molecular Formula

3627 (Gene_ID) P02778 (V22-P98) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4'-(Imidazol-1-yl)acetophenone
TRC-I577463-5G 5 g

4'-(Imidazol-1-yl)acetophenone

Sign In for Pricing
View Details
Congo Red (90%)
TRC-C685050-1G 1 g

Congo Red (90%)

Sign In for Pricing
View Details
LGALS12 (NM_001142538) Human Over-expression Lysate
LC428159 20 µg

LGALS12 (NM_001142538) Human Over-expression Lysate

Sign In for Pricing
View Details
ADAM21 Human Gene Knockout Kit (CRISPR)
KN421045 1 Kit

ADAM21 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FNIP1 Antibody: FITC
SPC-718D-FITC 100 µg

FNIP1 Antibody: FITC

Sign In for Pricing
View Details
NFS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]
TA805491AM 100 µL

NFS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details