Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXADR, Mouse (Biotinylated, HEK293, Avi-His)

CXADR protein is a key component of the epithelial apical junction complex, which maintains the integrity of tight junctions and enables leukocyte migration through adhesive interactions with JAML. This interaction activates γ-δ T cells and promotes tissue repair through cell signaling involving PI3 kinase and MAP kinase. CXADR Protein, Mouse (Biotinylated, HEK293, Avi-His) is the recombinant mouse-derived CXADR protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CXADR Protein, Mouse (Biotinylated, HEK293, Avi-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxadr-protein-mouse-hek-293-avi-his.html

Purity

98.0

Smiles

LSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAG

Molecular Formula

13052 (Gene_ID) P97792 (L20-G237) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUEDC1 Polyclonal Antibody
MBS9238511-01 0.1 mL

CUEDC1 Polyclonal Antibody

Sign In for Pricing
View Details
CUEDC1 Polyclonal Antibody
MBS9238511-02 5x 0.1 mL

CUEDC1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Sgip1 Pre-designed siRNA Set B
SI112817B 1 Each

Mouse Sgip1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-SEPT9 Antibody (FITC)
STJ502932 100 µg

Anti-SEPT9 Antibody (FITC)

Sign In for Pricing
View Details
MMP1 Antibody
KC-3194-01 50 μL

MMP1 Antibody

Sign In for Pricing
View Details
MMP1 Antibody
KC-3194-02 100 µL

MMP1 Antibody

Sign In for Pricing
View Details