Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Mouse (HEK293, His)

The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-mouse-217a-a-hek293-his.html

Purity

95.08

Smiles

CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP

Molecular Formula

60504 (Gene_ID) Q9JHX3 (C20-P236) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP13-3, CT (KRTAP13-3, KAP13.3, Keratin-associated protein 13-3) (FITC)
MBS6314868-01 0.2 mL

KRTAP13-3, CT (KRTAP13-3, KAP13.3, Keratin-associated protein 13-3) (FITC)

Sign In for Pricing
View Details
KRTAP13-3, CT (KRTAP13-3, KAP13.3, Keratin-associated protein 13-3) (FITC)
MBS6314868-02 5x 0.2 mL

KRTAP13-3, CT (KRTAP13-3, KAP13.3, Keratin-associated protein 13-3) (FITC)

Sign In for Pricing
View Details
Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein (N-Trx, 6His)
MBS2553256-01 0.01 mg

Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein (N-Trx, 6His)

Sign In for Pricing
View Details
Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein (N-Trx, 6His)
MBS2553256-02 0.05 mg

Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein (N-Trx, 6His)

Sign In for Pricing
View Details
Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein (N-Trx, 6His)
MBS2553256-03 5x 0.05 mg

Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein (N-Trx, 6His)

Sign In for Pricing
View Details
HIV-1 Tat Specific Factor 1, NT (HIV Tat-specific Factor 1, HTATSF1, dJ196E23.2, Tat-SF1) (MaxLight 550) discontinued
H6007-60N-ML550 100 µL

HIV-1 Tat Specific Factor 1, NT (HIV Tat-specific Factor 1, HTATSF1, dJ196E23.2, Tat-SF1) (MaxLight 550) discontinued

Sign In for Pricing
View Details