Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clumping factor A, S. aureus (P.pastoris, His)

Clumping factor A protein facilitates bacterial attachment to human fibrinogen gamma-chain, promoting the formation of bacterial clumps. It is a cell surface-associated protein and plays a role in bacterial virulence. Clumping factor A Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

Clumping factor A Protein, S. aureus (P.pastoris, His), Staphylococcus aureus, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus-p-pastoris-his.html

Smiles

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Molecular Formula

/ (Gene_ID) Q5HHM8 (G229-E559) (Accession)

Molecular Weight

Approximately 38.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZASP activation kit by CRISPRa
GA119475 1 Kit

Human ZASP activation kit by CRISPRa

Sign In for Pricing
View Details
RNF183 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1840905 3x 1.0 µg

RNF183 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Six1 Rabbit Polyclonal Antibody (FITC)
orb2128587 100 µL

Six1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CBR1 antibody
70R-49486 100 ul

CBR1 antibody

Sign In for Pricing
View Details
4-(2-Hydroxy-3-isopropylaminopropoxy)benzoic Acid
MBS6109418-01 5 mg

4-(2-Hydroxy-3-isopropylaminopropoxy)benzoic Acid

Sign In for Pricing
View Details
4-(2-Hydroxy-3-isopropylaminopropoxy)benzoic Acid
MBS6109418-02 5x 5 mg

4-(2-Hydroxy-3-isopropylaminopropoxy)benzoic Acid

Sign In for Pricing
View Details