Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clumping factor A, S. aureus (P.pastoris, His)

Clumping factor A protein facilitates bacterial attachment to human fibrinogen gamma-chain, promoting the formation of bacterial clumps. It is a cell surface-associated protein and plays a role in bacterial virulence. Clumping factor A Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

Clumping factor A Protein, S. aureus (P.pastoris, His), Staphylococcus aureus, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus-p-pastoris-his.html

Smiles

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Molecular Formula

/ (Gene_ID) Q5HHM8 (G229-E559) (Accession)

Molecular Weight

Approximately 38.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine G-Protein Coupled Receptor 15 (GPR15) ELISA Kit
MBS9909369-01 48 Well

Bovine G-Protein Coupled Receptor 15 (GPR15) ELISA Kit

Sign In for Pricing
View Details
Bovine G-Protein Coupled Receptor 15 (GPR15) ELISA Kit
MBS9909369-02 96 Well

Bovine G-Protein Coupled Receptor 15 (GPR15) ELISA Kit

Sign In for Pricing
View Details
Bovine G-Protein Coupled Receptor 15 (GPR15) ELISA Kit
MBS9909369-03 5x 96 Well

Bovine G-Protein Coupled Receptor 15 (GPR15) ELISA Kit

Sign In for Pricing
View Details
Bovine G-Protein Coupled Receptor 15 (GPR15) ELISA Kit
MBS9909369-04 10x 96 Well

Bovine G-Protein Coupled Receptor 15 (GPR15) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal to Human PRKCZ / PKC-Zeta
MBS240145-01 0.05 mg

Rabbit Polyclonal to Human PRKCZ / PKC-Zeta

Sign In for Pricing
View Details
Rabbit Polyclonal to Human PRKCZ / PKC-Zeta
MBS240145-02 5x 0.05 mg

Rabbit Polyclonal to Human PRKCZ / PKC-Zeta

Sign In for Pricing
View Details