SARS-CoV-2 S glycoprotein (D614G, HEK293, His)
SARS-CoV-2 S glycoprotein (D614G, HEK 293, His) is a SARS-CoV-2 S glycoprotein D614G protein with a His-flag. SARS-CoV-2 S glycoprotein (D614G) is a SARS-CoV-2 variant carrying the S protein amino acid (aa) change D614G, this variant has become the most prevalent form and has been associated with greater infectivity[1].
Product Specifications
Product Name Alternative
SARS-CoV-2 S glycoprotein (D614G, HEK293, His), Virus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sars-cov-2-s-glycoprotein-d614g-hek-293-his.html
Smiles
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
Molecular Formula
43740568 (Gene_ID) P0DTC2 (V16-R685, D614G) (Accession)
Molecular Weight
Approximately 77.8 kDa
References & Citations
[1]Leonid Yurkovetskiy, et al. Structural and Functional Analysis of the D614G SARS-CoV-2 Spike Protein Variant. Cell. 2020 Oct 29;183 (3) :739-751.e8.|[2]Jessica A Plante, et al. Spike mutation D614G alters SARS-CoV-2 fitness. Nature. 2021 Apr;592 (7852) :116-121.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details