Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 S glycoprotein (D614G, HEK293, His)

SARS-CoV-2 S glycoprotein (D614G, HEK 293, His) is a SARS-CoV-2 S glycoprotein D614G protein with a His-flag. SARS-CoV-2 S glycoprotein (D614G) is a SARS-CoV-2 variant carrying the S protein amino acid (aa) change D614G, this variant has become the most prevalent form and has been associated with greater infectivity[1].

Product Specifications

Product Name Alternative

SARS-CoV-2 S glycoprotein (D614G, HEK293, His), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-s-glycoprotein-d614g-hek-293-his.html

Smiles

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Molecular Formula

43740568 (Gene_ID) P0DTC2 (V16-R685, D614G) (Accession)

Molecular Weight

Approximately 77.8 kDa

References & Citations

[1]Leonid Yurkovetskiy, et al. Structural and Functional Analysis of the D614G SARS-CoV-2 Spike Protein Variant. Cell. 2020 Oct 29;183 (3) :739-751.e8.|[2]Jessica A Plante, et al. Spike mutation D614G alters SARS-CoV-2 fitness. Nature. 2021 Apr;592 (7852) :116-121.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSTR4 Rabbit Polyclonal Antibody (Biotin)
orb1599382 100 µL

SSTR4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
1-Bromo-2-ethoxy-3,5-bis (trifluoromethyl) benzene
PC1016647-01 250 mg

1-Bromo-2-ethoxy-3,5-bis (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Bromo-2-ethoxy-3,5-bis (trifluoromethyl) benzene
PC1016647-02 500 mg

1-Bromo-2-ethoxy-3,5-bis (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Bromo-2-ethoxy-3,5-bis (trifluoromethyl) benzene
PC1016647-03 1 g

1-Bromo-2-ethoxy-3,5-bis (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Bromo-2-ethoxy-3,5-bis (trifluoromethyl) benzene
PC1016647-04 5 g

1-Bromo-2-ethoxy-3,5-bis (trifluoromethyl) benzene

Sign In for Pricing
View Details
DLL1 Knockout HAP1 Polyclonal Cells
ARG38944 1 Million

DLL1 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details