Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclin-H/CCNH, Human (His)

Product Specifications

UNSPSC Description

Cyclin-H/CCNH plays a key role as a modulator of CDK7, the catalytic subunit of the CDK-activated kinase (CAK) complex. This enzyme complex activates cyclin-related kinases such as CDK1, CDK2, CDK4, and CDK6 through threonine phosphorylation. Cyclin-H/CCNH Protein, Human (His) is the recombinant human-derived Cyclin-H/CCNH protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cyclin-H/CCNH Protein, Human (His) is 323 a.a., with molecular weight of 34-39 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclin-h-ccnh-protein-human-his.html

Purity

95.0

Smiles

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Molecular Weight

34-39 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), CF640R conjugate, 0.1mg/mL
BNC403280-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Di-m-tolyl Phosphate
TRC-D436800-1G 1 g

Di-m-tolyl Phosphate

Sign In for Pricing
View Details
Protein A/G Coated - 96 well Solid plates - White PS
MCW08F-PAG 10x 96 Well Plates

Protein A/G Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
Carbosulfan
TRC-C177710-10MG 10 mg

Carbosulfan

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS624738 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
SARS-CoV-2 N Protein Mouse Monoclonal Antibody [Clone ID: OTI4B9]
CF814506 100 µg

SARS-CoV-2 N Protein Mouse Monoclonal Antibody [Clone ID: OTI4B9]

Sign In for Pricing
View Details