Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclin-H/CCNH, Human (His)

Product Specifications

UNSPSC Description

Cyclin-H/CCNH plays a key role as a modulator of CDK7, the catalytic subunit of the CDK-activated kinase (CAK) complex. This enzyme complex activates cyclin-related kinases such as CDK1, CDK2, CDK4, and CDK6 through threonine phosphorylation. Cyclin-H/CCNH Protein, Human (His) is the recombinant human-derived Cyclin-H/CCNH protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cyclin-H/CCNH Protein, Human (His) is 323 a.a., with molecular weight of 34-39 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclin-h-ccnh-protein-human-his.html

Purity

95.0

Smiles

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Molecular Weight

34-39 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH6 (DNA Mismatch Repair Protein) (MSH6/3089), CF405S conjugate, 0.1mg/mL
BNC043089-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3089), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cpm Mouse Gene Knockout Kit (CRISPR)
KN503759 1 Kit

Cpm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF594 conjugate, 0.1mg/mL
BNC941824-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL
BNCB2054-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCDH15 Mouse Monoclonal Antibody [Clone ID: OTI7F10]
CF812881 100 µg

PCDH15 Mouse Monoclonal Antibody [Clone ID: OTI7F10]

Sign In for Pricing
View Details
FGF9 Polyclonal Antibody
E-AB-10180-01 20 µL

FGF9 Polyclonal Antibody

Sign In for Pricing
View Details