Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclin-H/CCNH, Human (His)

Product Specifications

UNSPSC Description

Cyclin-H/CCNH plays a key role as a modulator of CDK7, the catalytic subunit of the CDK-activated kinase (CAK) complex. This enzyme complex activates cyclin-related kinases such as CDK1, CDK2, CDK4, and CDK6 through threonine phosphorylation. Cyclin-H/CCNH Protein, Human (His) is the recombinant human-derived Cyclin-H/CCNH protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cyclin-H/CCNH Protein, Human (His) is 323 a.a., with molecular weight of 34-39 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclin-h-ccnh-protein-human-his.html

Purity

95.0

Smiles

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Molecular Weight

34-39 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trap1 Antibody: FITC
SMC-207D-FITC 100 µg

Trap1 Antibody: FITC

Sign In for Pricing
View Details
N-Acetylpiperazine-N’-(4-phenol) Ketoconazole
TRC-A187500-5MG 5 mg

N-Acetylpiperazine-N’-(4-phenol) Ketoconazole

Sign In for Pricing
View Details
Midkine (MDK) (NM_001012334) Human Over-expression Lysate
LC425316 20 µg

Midkine (MDK) (NM_001012334) Human Over-expression Lysate

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF594 conjugate, 0.1mg/mL
BNC941563-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human STK25 activation kit by CRISPRa
GA107169 1 Kit

Human STK25 activation kit by CRISPRa

Sign In for Pricing
View Details
Human G2A (GPR132) activation kit by CRISPRa
GA109321 1 Kit

Human G2A (GPR132) activation kit by CRISPRa

Sign In for Pricing
View Details