Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal gp96/HSP90B1/GRP94 Antibody (2H3) [Alexa Fluor 488]
NBP1-04346AF488 0.1 mL

Mouse Monoclonal gp96/HSP90B1/GRP94 Antibody (2H3) [Alexa Fluor 488]

Request Quote
View Details
SEPTIN6 (NM_015129) Human Over-expression Lysate
LY402410 100 µg

SEPTIN6 (NM_015129) Human Over-expression Lysate

Request Quote
View Details
LY96, Lymphocyte Antigen 96, Recombinant, Human, aa17-160, His-GST-Tag (Lymphocyte Antigen 96)
374101-01 20 µg

LY96, Lymphocyte Antigen 96, Recombinant, Human, aa17-160, His-GST-Tag (Lymphocyte Antigen 96)

Request Quote
View Details
LY96, Lymphocyte Antigen 96, Recombinant, Human, aa17-160, His-GST-Tag (Lymphocyte Antigen 96)
374101-02 100 µg

LY96, Lymphocyte Antigen 96, Recombinant, Human, aa17-160, His-GST-Tag (Lymphocyte Antigen 96)

Request Quote
View Details
LY96, Lymphocyte Antigen 96, Recombinant, Human, aa17-160, His-GST-Tag (Lymphocyte Antigen 96)
374101-03 1 mg

LY96, Lymphocyte Antigen 96, Recombinant, Human, aa17-160, His-GST-Tag (Lymphocyte Antigen 96)

Request Quote
View Details
Magic™ Membrane Protein Mouse Tmem59l (Transmembrane protein 59-like) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX1636K Each

Magic™ Membrane Protein Mouse Tmem59l (Transmembrane protein 59-like) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Request Quote
View Details