Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CSFV Viroporin p7 Antibody (1A037)
VK712025-01 50 µg

Anti-CSFV Viroporin p7 Antibody (1A037)

Sign In for Pricing
View Details
Anti-CSFV Viroporin p7 Antibody (1A037)
VK712025-02 100 µg

Anti-CSFV Viroporin p7 Antibody (1A037)

Sign In for Pricing
View Details
Swi5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV640828 1.0 µg DNA

Swi5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
KCNJ12 ORF Vector (Human) (pORF)
ORF005541 1.0 µg DNA

KCNJ12 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal Axin-2 Antibody [DyLight 350]
NBP3-18241UV 0.1 mL

Rabbit Polyclonal Axin-2 Antibody [DyLight 350]

Sign In for Pricing
View Details
Recombinant Human MIF4GD, His-tagged
MIF4GD-882H 25 µg

Recombinant Human MIF4GD, His-tagged

Sign In for Pricing
View Details