Wnt8b, Mouse (Myc, His-SUMO)
Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html
Purity
90.00
Smiles
WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
Molecular Formula
22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Cr7906-500gEcoli 500 µg (E. coli)
Recombinant Streptococcus Pneumoniae rnhB Protein (aa 1-259) (strain JJA)
Sign In for Pricing
View Details 
MBS2127129-01 24 Strip Well
Human A Disintegrin And Metalloproteinase With Thrombospondin 12 (ADAMTS12) ELISA Kit
Sign In for Pricing
View Details MBS2127129-02 48 Well
Human A Disintegrin And Metalloproteinase With Thrombospondin 12 (ADAMTS12) ELISA Kit
Sign In for Pricing
View Details MBS2127129-03 96 Well
Human A Disintegrin And Metalloproteinase With Thrombospondin 12 (ADAMTS12) ELISA Kit
Sign In for Pricing
View Details MBS2127129-04 5x 96 Well
Human A Disintegrin And Metalloproteinase With Thrombospondin 12 (ADAMTS12) ELISA Kit
Sign In for Pricing
View Details 
MBS2127129-05 10x 96 Well
Human A Disintegrin And Metalloproteinase With Thrombospondin 12 (ADAMTS12) ELISA Kit
Sign In for Pricing
View Details