Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl36a Rat shRNA Plasmid (Locus ID 292964)
TR708490 1 Kit

Rpl36a Rat shRNA Plasmid (Locus ID 292964)

Sign In for Pricing
View Details
VEGF-B Overexpression Lysate (Native) - (Dry Ice)
NBL1-17713 0.1 mg

VEGF-B Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
ATP5C1
pro-1494 5µg

ATP5C1

Sign In for Pricing
View Details
Gpx3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6952005 3x 1.0 µg

Gpx3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human hsa-miR-3940-5p miRNA Antagomir
abx886653-01 10 nmol

Human hsa-miR-3940-5p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-3940-5p miRNA Antagomir
abx886653-02 20 nmol

Human hsa-miR-3940-5p miRNA Antagomir

Sign In for Pricing
View Details