Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF11 (Transcription Initiation Factor TFIID Subunit 11, Transcription Initiation Factor TFIID 28kD Subunit, TAF (II) 28, TAFII-28, TAFII28, TFIID Subunit p30-beta, TAF2I, PRO2134, MGC15243) (PE)
134173-PE 100 µL

TAF11 (Transcription Initiation Factor TFIID Subunit 11, Transcription Initiation Factor TFIID 28kD Subunit, TAF (II) 28, TAFII-28, TAFII28, TFIID Subunit p30-beta, TAF2I, PRO2134, MGC15243) (PE)

Sign In for Pricing
View Details
Human Proteinase 3 (PR3) ELISA Kit
YLA4161HU-01 48 Tests

Human Proteinase 3 (PR3) ELISA Kit

Sign In for Pricing
View Details
Human Proteinase 3 (PR3) ELISA Kit
YLA4161HU-02 96 Tests

Human Proteinase 3 (PR3) ELISA Kit

Sign In for Pricing
View Details
Zinc-Copper Couple
TRC-Z439000-1G 1 g

Zinc-Copper Couple

Sign In for Pricing
View Details
PKA gamma Rabbit pAb
E47R3964 100 µL

PKA gamma Rabbit pAb

Sign In for Pricing
View Details
Dab2ip sgRNA CRISPR Lentivector (Rat) (Target 2)
K7013703 1.0 µg DNA

Dab2ip sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details