Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR2W1 siRNA
abx927133-01 15 nmol

Human OR2W1 siRNA

Sign In for Pricing
View Details
Human OR2W1 siRNA
abx927133-02 30 nmol

Human OR2W1 siRNA

Sign In for Pricing
View Details
Trp73 (NM_001126330) Mouse Recombinant Protein
TP509197 20 µg

Trp73 (NM_001126330) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse Ptk6 Protein, His , GST-tagged
MK0625M 10 µg

Recombinant Mouse Ptk6 Protein, His , GST-tagged

Sign In for Pricing
View Details
Mouse Myeloperoxidase (MPO) ELISA Kit
abx052406-01 96 Tests

Mouse Myeloperoxidase (MPO) ELISA Kit

Sign In for Pricing
View Details
Mouse Myeloperoxidase (MPO) ELISA Kit
abx052406-02 5x 96 Tests

Mouse Myeloperoxidase (MPO) ELISA Kit

Sign In for Pricing
View Details