Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBBP4 (Retinoblastoma Binding Protein p4, NURF55, RBAP48) (HRP)
MBS6435069-01 0.1 mL

RBBP4 (Retinoblastoma Binding Protein p4, NURF55, RBAP48) (HRP)

Sign In for Pricing
View Details
RBBP4 (Retinoblastoma Binding Protein p4, NURF55, RBAP48) (HRP)
MBS6435069-02 5x 0.1 mL

RBBP4 (Retinoblastoma Binding Protein p4, NURF55, RBAP48) (HRP)

Sign In for Pricing
View Details
Human Histone Deacetylase 1 (HDAC1) ELISA Kit
abx571352 96 Well

Human Histone Deacetylase 1 (HDAC1) ELISA Kit

Sign In for Pricing
View Details
Vwa5a Rat shRNA Plasmid (Locus ID 301097)
TR713671 1 Kit

Vwa5a Rat shRNA Plasmid (Locus ID 301097)

Sign In for Pricing
View Details
HSPA13 Antibody - middle region
MBS3222071-01 0.1 mL

HSPA13 Antibody - middle region

Sign In for Pricing
View Details
HSPA13 Antibody - middle region
MBS3222071-02 5x 0.1 mL

HSPA13 Antibody - middle region

Sign In for Pricing
View Details