Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAT1A Polyclonal Antibody
E55A04180 100 µg

MAT1A Polyclonal Antibody

Sign In for Pricing
View Details
Mmu-miR-463-3p miRNA Antagomir
CIN0458-01 10 nmol

Mmu-miR-463-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-463-3p miRNA Antagomir
CIN0458-02 20 nmol

Mmu-miR-463-3p miRNA Antagomir

Sign In for Pricing
View Details
Strawberry (fra a 1)
MBS3040048-01 0.1 mg

Strawberry (fra a 1)

Sign In for Pricing
View Details
Strawberry (fra a 1)
MBS3040048-02 5x 0.1 mg

Strawberry (fra a 1)

Sign In for Pricing
View Details
BMP7 Rabbit Polyclonal Antibody
AP31724PU-N 100 µg

BMP7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details