Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPL2 Antibody
PHY3939S 150 μg

PPL2 Antibody

Sign In for Pricing
View Details
OTSSP167 hydrochloride 10mg
A22184-10 10 mg

OTSSP167 hydrochloride 10mg

Sign In for Pricing
View Details
Human PRR20A knockdown cell line
ABC-KD12225 1 Vial

Human PRR20A knockdown cell line

Sign In for Pricing
View Details
ZNFX1 Protein Vector (Human) (pPB-C-His)
PV145930 500 ng

ZNFX1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Fmoc-L-Thr (tBu) -Wang Resin
abx095113-01 5 g

Fmoc-L-Thr (tBu) -Wang Resin

Sign In for Pricing
View Details
Fmoc-L-Thr (tBu) -Wang Resin
abx095113-02 10 g

Fmoc-L-Thr (tBu) -Wang Resin

Sign In for Pricing
View Details