Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL35AP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1974107 1.0 µg DNA

RPL35AP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
2,4-Dichlorophenoxyacetic Acid (2,4-D)
30631001-1 100 g

2,4-Dichlorophenoxyacetic Acid (2,4-D)

Sign In for Pricing
View Details
TCF12 Protein Vector (Mouse) (pPM-C-His)
PV237045 500 ng

TCF12 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CHD3 Polyclonal Antibody, HRP Conjugated
bs-8162R-HRP 100 µL

CHD3 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Cyp4f40 Protein Vector (Mouse) (pPM-C-HA)
PV169812 500 ng

Cyp4f40 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
pCMV-3×FLAG-CCNQ-Neo Plasmid
PVT60970 2 µg

pCMV-3×FLAG-CCNQ-Neo Plasmid

Sign In for Pricing
View Details