Wnt8b, Mouse (Myc, His-SUMO)
Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html
Purity
90.00
Smiles
WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
Molecular Formula
22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7479703 1.0 µg DNA
Spryd4 sgRNA CRISPR Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details NE025/Bio 1 mL
Rabbit anti Bovine Carboxypeptidase A, conjugated to Biotin
Sign In for Pricing
View Details 
SPS-RA23-276 1 g
DiagSupport™ Fmoc-Lys (Boc) -MHPA PEG-Polystyrene Resin, 90 µm, 0.2-0.25 mmol/g
Sign In for Pricing
View Details