Wnt8b, Mouse (Myc, His-SUMO)
Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html
Purity
90.00
Smiles
WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
Molecular Formula
22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx6365-1mgEcoli 1 mg (E. coli)
Recombinant Campylobacter Jejuni rpsD Protein (aa 1-208)
Sign In for Pricing
View Details 
bsm-60560R-BF680 100 µL
Fibrillarin Recombinant Antibody, AbBy Fluor™ 680 Conjugated
Sign In for Pricing
View Details MBS7042668-01 0.02 mg
Ectonucleoside triphosphate diphosphohydrolase 5
Sign In for Pricing
View Details 
MBS7042668-02 0.1 mg
Ectonucleoside triphosphate diphosphohydrolase 5
Sign In for Pricing
View Details MBS7042668-03 5x 0.1 mg
Ectonucleoside triphosphate diphosphohydrolase 5
Sign In for Pricing
View Details 
KN209151BN 1 Kit
Dystrophia myotonica protein kinase (DMPK) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details