Wnt8b, Mouse (Myc, His-SUMO)
Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html
Purity
90.00
Smiles
WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
Molecular Formula
22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400003-100 1x 100 µL
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040158-500 1x 500 µL
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details