TMSB4X/Thymosin beta 4, Human
TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. TMSB4X/Thymosin beta 4 Protein, Human is the recombinant human-derived Thymosin beta 4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
TMSB4X/Thymosin beta 4 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/thymosin-beta-4-protein-human.html
Purity
97.00
Smiles
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Molecular Formula
7114 (Gene_ID) P62328 (S2-S44) (Accession)
Molecular Weight
Approximately 12 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
JIK (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine
JIK (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine
FAM168B (Myelin-Associated Neurite-Outgrowth inhibitor, Mani, p20, FAM168B, KIAA0280L, MANI) (FITC)