Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Pig

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Pig is the recombinant Porcine-derived GM-CSF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GM-CSF Protein, Pig, Porcine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-porcine.html

Purity

99.00

Smiles

APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK

Molecular Formula

397208 (Gene_ID) Q29118 (A18-K144) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS639559 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF488A conjugate, 0.1mg/mL
BNC882206-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recoverin (RCVRN) Human Gene Knockout Kit (CRISPR)
KN400428 1 Kit

Recoverin (RCVRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CC2D1B Human Gene Knockout Kit (CRISPR)
KN419061 1 Kit

CC2D1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL21 Rabbit Polyclonal Antibody
TA381043 100 µL

RPL21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rbm11 Mouse Gene Knockout Kit (CRISPR)
KN514546 1 Kit

Rbm11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details