Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Pig

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Pig is the recombinant Porcine-derived GM-CSF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GM-CSF Protein, Pig, Porcine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-porcine.html

Purity

99.00

Smiles

APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK

Molecular Formula

397208 (Gene_ID) Q29118 (A18-K144) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT6 siRNA (Human)
orb1860565-01 15 nmol

GALNT6 siRNA (Human)

Sign In for Pricing
View Details
GALNT6 siRNA (Human)
orb1860565-02 30 nmol

GALNT6 siRNA (Human)

Sign In for Pricing
View Details
Prolactin (LTH, Luteotropic Hormone, Lactogenic Hormone) (Biotin)
P9009-05-Biotin 100 µL

Prolactin (LTH, Luteotropic Hormone, Lactogenic Hormone) (Biotin)

Sign In for Pricing
View Details
FAU Protein Vector (Human) (pPB-C-His)
PV077945 500 ng

FAU Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PCDH1 Double Nickase Plasmid (h2)
sc-404977-NIC-2 20 µg

PCDH1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Lentiviral mouse Abcc5 shRNA (UAS) - Lentiviral mouse Abcc5 shRNA (UAS, GFP) plasmid
GTR15196654 1 Vial

Lentiviral mouse Abcc5 shRNA (UAS) - Lentiviral mouse Abcc5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details