Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCH2, Human (Cell-Free, His, SUMO)

The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

MARCH2 Protein, Human (Cell-Free, His, SUMO), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/march2-protein-human-cf-his-sumo.html

Smiles

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

Molecular Formula

/ (Gene_ID) Q9P0N8 (M1-V246) (Accession)

Molecular Weight

43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human UBAP2L shRNA (UAS) - Lentiviral human UBAP2L shRNA (UAS) plasmid
GTR15100831 1 Vial

Lentiviral human UBAP2L shRNA (UAS) - Lentiviral human UBAP2L shRNA (UAS) plasmid

Ask
View Details
CDC42EP1 Rabbit Polyclonal Antibody
TA362364 100 µL

CDC42EP1 Rabbit Polyclonal Antibody

Ask
View Details
CPS1 (Carbamoyl-phosphate Synthase [Ammonia], Mitochondrial, Carbamoyl-phosphate Synthetase I, CPSase I) (HRP)
MBS6400255-01 0.1 mL

CPS1 (Carbamoyl-phosphate Synthase [Ammonia], Mitochondrial, Carbamoyl-phosphate Synthetase I, CPSase I) (HRP)

Ask
View Details
CPS1 (Carbamoyl-phosphate Synthase [Ammonia], Mitochondrial, Carbamoyl-phosphate Synthetase I, CPSase I) (HRP)
MBS6400255-02 5x 0.1 mL

CPS1 (Carbamoyl-phosphate Synthase [Ammonia], Mitochondrial, Carbamoyl-phosphate Synthetase I, CPSase I) (HRP)

Ask
View Details
GOLGA6A, CT (GOLGA6A, GLP, GOLGA6, Golgin subfamily A member 6A, Golgin linked to PML, Golgin-like protein) (PE) discontinued
036160-PE 200 µL

GOLGA6A, CT (GOLGA6A, GLP, GOLGA6, Golgin subfamily A member 6A, Golgin linked to PML, Golgin-like protein) (PE) discontinued

Ask
View Details