Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCH2, Human (Cell-Free, His, SUMO)

The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

MARCH2 Protein, Human (Cell-Free, His, SUMO), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/march2-protein-human-cf-his-sumo.html

Smiles

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

Molecular Formula

/ (Gene_ID) Q9P0N8 (M1-V246) (Accession)

Molecular Weight

43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Legionella pneumophila antigen, LP Ag ELISA Kit
SL1047Hu_1-01 96 Tests

Human Legionella pneumophila antigen, LP Ag ELISA Kit

Ask
View Details
Human Legionella pneumophila antigen, LP Ag ELISA Kit
SL1047Hu_1-02 48 Tests

Human Legionella pneumophila antigen, LP Ag ELISA Kit

Ask
View Details
Polq (NM_029977) Mouse Tagged ORF Clone
MG215198 10 µg

Polq (NM_029977) Mouse Tagged ORF Clone

Ask
View Details