MARCH2, Human (Cell-Free, His, SUMO)
The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
MARCH2 Protein, Human (Cell-Free, His, SUMO), Human, E. coli Cell-free
UNSPSC
12352202
Type
Reference compound
Assay Protocol
https://www.medchemexpress.com/cytokines/march2-protein-human-cf-his-sumo.html
Smiles
MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
Molecular Formula
/ (Gene_ID) Q9P0N8 (M1-V246) (Accession)
Molecular Weight
43 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS7075981 Inquire
Recombinant Synechococcus sp. Photosystem II reaction center protein L (psbL), partial
Ask
View Details 
MBS6220617-01 0.1 mL
ITGAX/CD11c, NT (ITGAX, CD11C, Integrin alpha-X, CD11 antigen-like family member C, Leu M5, Leukocyte adhesion glycoprotein p150,95 alpha chain, Leukocyte adhesion receptor p150,95, CD_antigen=CD11c) (MaxLight 650)
Ask
View Details MBS6220617-02 5x 0.1 mL
ITGAX/CD11c, NT (ITGAX, CD11C, Integrin alpha-X, CD11 antigen-like family member C, Leu M5, Leukocyte adhesion glycoprotein p150,95 alpha chain, Leukocyte adhesion receptor p150,95, CD_antigen=CD11c) (MaxLight 650)
Ask
View Details 