Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 alpha, Human (Biotinylated, HEK293, Avi)

IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][2]. IL-1 alpha protein, Human (Biotinylated, HEK293, Avi) is a biotinylated recombinant protein with Avi label that consists of 159 amino acids (S113-A271) and is produced by E. coli.

Product Specifications

Product Name Alternative

IL-1 alpha Protein, Human (Biotinylated, HEK293, Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-alpha-protein-human-biotinylated-hek293-avi.html

Purity

98.0

Smiles

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Molecular Formula

3552 (Gene_ID) P01583 (S113-A271) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Cavalli G, et al. Interleukin 1α: a comprehensive review on the role of IL-1α in the pathogenesis and treatment of autoimmune and inflammatory diseases. Autoimmun Rev. 2021 Mar;20 (3) :102763.|[2]Wu T, et al. Involvement of p38 and p42/44 MAP kinases and protein kinase C in the interferon-gamma and interleukin-1alpha-induced phosphorylation of 85-kDa cytosolic phospholipase A (2) in primary human bronchial epithelial cells. Cytokine. 2004 Jan 7;25 (1) :11-20.|[3]Um JY, et al. Functional polymorphism of IL-1 alpha and its potential role in obesity in humans and mice. PLoS One. 2011;6 (12) :e29524.|[4]Guo C, et al. IL-1α induces apoptosis and inhibits the osteoblast differentiation of MC3T3-E1 cells through the JNK and p38 MAPK pathways. Int J Mol Med. 2016 Jul;38 (1) :319-27.|[5]Malik A, et al. Function and regulation of IL-1α in inflammatory diseases and cancer. Immunol Rev. 2018 Jan;281 (1) :124-137.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CADM3 Protein, Human, Recombinant (His Tag)
PH51246M2-01 100 µg

CADM3 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
CADM3 Protein, Human, Recombinant (His Tag)
PH51246M2-02 1 mg

CADM3 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
APRT (Adenine Phosphoribosyltransferase) (AP) discontinued
123454-AP 100 µL

APRT (Adenine Phosphoribosyltransferase) (AP) discontinued

Sign In for Pricing
View Details
Mouse Alternative macrophage activation-associated CC chemokine 1,AMAC-1 ELISA Kit
CN-03409M1 96T

Mouse Alternative macrophage activation-associated CC chemokine 1,AMAC-1 ELISA Kit

Sign In for Pricing
View Details
ZNF346 (Zinc Finger Protein 346, Zfp346, Just Another Zinc Finger Protein, JAZ) (MaxLight 490)
MBS6399179-01 0.1 mL

ZNF346 (Zinc Finger Protein 346, Zfp346, Just Another Zinc Finger Protein, JAZ) (MaxLight 490)

Sign In for Pricing
View Details
ZNF346 (Zinc Finger Protein 346, Zfp346, Just Another Zinc Finger Protein, JAZ) (MaxLight 490)
MBS6399179-02 5x 0.1 mL

ZNF346 (Zinc Finger Protein 346, Zfp346, Just Another Zinc Finger Protein, JAZ) (MaxLight 490)

Sign In for Pricing
View Details