Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 alpha, Human (Biotinylated, HEK293, Avi)

IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][2]. IL-1 alpha protein, Human (Biotinylated, HEK293, Avi) is a biotinylated recombinant protein with Avi label that consists of 159 amino acids (S113-A271) and is produced by E. coli.

Product Specifications

Product Name Alternative

IL-1 alpha Protein, Human (Biotinylated, HEK293, Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-alpha-protein-human-biotinylated-hek293-avi.html

Purity

98.0

Smiles

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Molecular Formula

3552 (Gene_ID) P01583 (S113-A271) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Cavalli G, et al. Interleukin 1α: a comprehensive review on the role of IL-1α in the pathogenesis and treatment of autoimmune and inflammatory diseases. Autoimmun Rev. 2021 Mar;20 (3) :102763.|[2]Wu T, et al. Involvement of p38 and p42/44 MAP kinases and protein kinase C in the interferon-gamma and interleukin-1alpha-induced phosphorylation of 85-kDa cytosolic phospholipase A (2) in primary human bronchial epithelial cells. Cytokine. 2004 Jan 7;25 (1) :11-20.|[3]Um JY, et al. Functional polymorphism of IL-1 alpha and its potential role in obesity in humans and mice. PLoS One. 2011;6 (12) :e29524.|[4]Guo C, et al. IL-1α induces apoptosis and inhibits the osteoblast differentiation of MC3T3-E1 cells through the JNK and p38 MAPK pathways. Int J Mol Med. 2016 Jul;38 (1) :319-27.|[5]Malik A, et al. Function and regulation of IL-1α in inflammatory diseases and cancer. Immunol Rev. 2018 Jan;281 (1) :124-137.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Odam activation kit by CRISPRa
GA208239 1 Kit

Mouse Odam activation kit by CRISPRa

Sign In for Pricing
View Details
BRP44 (Brain Protein 44, DKFZp564B167, MGC125752, MGC125753) (MaxLight 405) discontinued
243889-ML405 100 µL

BRP44 (Brain Protein 44, DKFZp564B167, MGC125752, MGC125753) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PLEKHM1P (LOC440456, Putative Pleckstrin Homology Domain-containing Family M Member 1P)
MBS641178-01 0.05 mg

PLEKHM1P (LOC440456, Putative Pleckstrin Homology Domain-containing Family M Member 1P)

Sign In for Pricing
View Details
PLEKHM1P (LOC440456, Putative Pleckstrin Homology Domain-containing Family M Member 1P)
MBS641178-02 5x 0.05 mg

PLEKHM1P (LOC440456, Putative Pleckstrin Homology Domain-containing Family M Member 1P)

Sign In for Pricing
View Details
TSPO2 AAV Vector (Mouse) (CMV)
48604104 1 µg

TSPO2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Rabbit anti-Salmonella heidelberg D-serine dehydratase polyclonal Antibody, HRP conjugated
MBS1497575-01 0.05 mg

Rabbit anti-Salmonella heidelberg D-serine dehydratase polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details