Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21, Mouse (122a.a)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (122a.a) is the recombinant mouse-derived IL-21 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-21 Protein, Mouse (122a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21-protein-mouse-122a-a.html

Purity

98.0

Smiles

PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

60505 (Gene_ID) Q9ES17 (P25-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-kB p65 (RELA) Rabbit Polyclonal Antibody
AP02554PU-N 100 µL

NF-kB p65 (RELA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Labeled Deoxyribonuclease (DNase 1), 1mL 40nm
GE-02-40 1 mL

Colloidal Gold Labeled Deoxyribonuclease (DNase 1), 1mL 40nm

Sign In for Pricing
View Details
TRIM39-RPP21 (NM_001199119) Human Over-expression Lysate
LY434279 100 µg

TRIM39-RPP21 (NM_001199119) Human Over-expression Lysate

Sign In for Pricing
View Details
Monoethyl Ester 1,2-Ethanedisulfonic Acid
TRC-M857720-250MG 250 mg

Monoethyl Ester 1,2-Ethanedisulfonic Acid

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9/781), Biotin conjugate, 0.1mg/mL
BNCB0781-500 1x 500 µL

Carbonic Anhydrase IX (CA9/781), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human LEFTY2 Protein (His Tag)
PKSH032686-01 10 µg

Recombinant Human LEFTY2 Protein (His Tag)

Sign In for Pricing
View Details