Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21, Mouse (122a.a)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (122a.a) is the recombinant mouse-derived IL-21 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-21 Protein, Mouse (122a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21-protein-mouse-122a-a.html

Purity

98.0

Smiles

PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

60505 (Gene_ID) Q9ES17 (P25-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine
PC100746-01 50 mg

1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine

Sign In for Pricing
View Details
1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine
PC100746-02 100 mg

1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine

Sign In for Pricing
View Details
1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine
PC100746-03 500 mg

1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine

Sign In for Pricing
View Details
1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine
PC100746-04 1 g

1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine

Sign In for Pricing
View Details
1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine
PC100746-05 5 g

1- (3-Bromophenyl) -2,2,2-trifluoroethan-1-amine

Sign In for Pricing
View Details
PIM2 Antibody
F54449-0.08ML 0.08 mL

PIM2 Antibody

Sign In for Pricing
View Details