Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTBP2 Antibody
RQ6292 100 µg

PTBP2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IGF-II R/IGF2R Antibody (MEM-238) [DyLight 550]
NB500-464R 0.1 mL

Mouse Monoclonal IGF-II R/IGF2R Antibody (MEM-238) [DyLight 550]

Sign In for Pricing
View Details
Recombinant Salmonella newport L-seryl-tRNA (Sec) selenium transferase
MBS1117581-01 0.02 mg (E-Coli)

Recombinant Salmonella newport L-seryl-tRNA (Sec) selenium transferase

Sign In for Pricing
View Details
Recombinant Salmonella newport L-seryl-tRNA (Sec) selenium transferase
MBS1117581-02 0.02 mg (Yeast)

Recombinant Salmonella newport L-seryl-tRNA (Sec) selenium transferase

Sign In for Pricing
View Details
Recombinant Salmonella newport L-seryl-tRNA (Sec) selenium transferase
MBS1117581-03 0.1 mg (E-Coli)

Recombinant Salmonella newport L-seryl-tRNA (Sec) selenium transferase

Sign In for Pricing
View Details
Recombinant Salmonella newport L-seryl-tRNA (Sec) selenium transferase
MBS1117581-04 0.1 mg (Yeast)

Recombinant Salmonella newport L-seryl-tRNA (Sec) selenium transferase

Sign In for Pricing
View Details