Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF713, ID (ZNF713, Zinc finger protein 713) (MaxLight 405)
MBS6367564-01 0.1 mL

ZNF713, ID (ZNF713, Zinc finger protein 713) (MaxLight 405)

Sign In for Pricing
View Details
ZNF713, ID (ZNF713, Zinc finger protein 713) (MaxLight 405)
MBS6367564-02 5x 0.1 mL

ZNF713, ID (ZNF713, Zinc finger protein 713) (MaxLight 405)

Sign In for Pricing
View Details
OR5AS1 (NM_001001921) Human Tagged ORF Clone Lentiviral Particle
RC217442L4V 200 µL

OR5AS1 (NM_001001921) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ST2 siRNA (h)
sc-40035 10 µM

ST2 siRNA (h)

Sign In for Pricing
View Details
RHOA Polyclonal Antibody
E55A04552 100 µg

RHOA Polyclonal Antibody

Sign In for Pricing
View Details
N-Tosyl-2-iodoaniline-d4
TRC-T664062-10MG 10 mg

N-Tosyl-2-iodoaniline-d4

Sign In for Pricing
View Details