Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CE045, ID (UPF0544 protein C5orf45, C5orf45, ) (Biotin) discontinued
033740-Biotin 200 µL

CE045, ID (UPF0544 protein C5orf45, C5orf45, ) (Biotin) discontinued

Sign In for Pricing
View Details
Outer capsid glycoprotein VP7 Antibody, FITC conjugated
A50290-100UG 100 µg

Outer capsid glycoprotein VP7 Antibody, FITC conjugated

Sign In for Pricing
View Details
MCP-3, CCL7, murine (mouse)
RC335-18 2ug

MCP-3, CCL7, murine (mouse)

Sign In for Pricing
View Details
RPH3A, CT (RPH3A, KIAA0985, Rabphilin-3A, Exophilin-1) (MaxLight 550)
MBS6343277-01 0.1 mL

RPH3A, CT (RPH3A, KIAA0985, Rabphilin-3A, Exophilin-1) (MaxLight 550)

Sign In for Pricing
View Details
RPH3A, CT (RPH3A, KIAA0985, Rabphilin-3A, Exophilin-1) (MaxLight 550)
MBS6343277-02 5x 0.1 mL

RPH3A, CT (RPH3A, KIAA0985, Rabphilin-3A, Exophilin-1) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Encephalitozoon cuniculi Probable asparagine--tRNA ligase, cytoplasmic (ECU09_1680), partial
MBS1321185-01 0.05 mg (E-Coli)

Recombinant Encephalitozoon cuniculi Probable asparagine--tRNA ligase, cytoplasmic (ECU09_1680), partial

Sign In for Pricing
View Details