Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRTM2, CT (LRRTM2, KIAA0416, LRRN2, Leucine-rich repeat transmembrane neuronal protein 2, Leucine-rich repeat neuronal 2 protein) (MaxLight 405)
MBS6317411-01 0.1 mL

LRRTM2, CT (LRRTM2, KIAA0416, LRRN2, Leucine-rich repeat transmembrane neuronal protein 2, Leucine-rich repeat neuronal 2 protein) (MaxLight 405)

Sign In for Pricing
View Details
LRRTM2, CT (LRRTM2, KIAA0416, LRRN2, Leucine-rich repeat transmembrane neuronal protein 2, Leucine-rich repeat neuronal 2 protein) (MaxLight 405)
MBS6317411-02 5x 0.1 mL

LRRTM2, CT (LRRTM2, KIAA0416, LRRN2, Leucine-rich repeat transmembrane neuronal protein 2, Leucine-rich repeat neuronal 2 protein) (MaxLight 405)

Sign In for Pricing
View Details
B3GNT4, ID (B3GNT4, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) (FITC)
MBS6277143-01 0.2 mL

B3GNT4, ID (B3GNT4, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) (FITC)

Sign In for Pricing
View Details
B3GNT4, ID (B3GNT4, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) (FITC)
MBS6277143-02 5x 0.2 mL

B3GNT4, ID (B3GNT4, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) (FITC)

Sign In for Pricing
View Details
Ndufc1 (NM_025523) Mouse Recombinant Protein
PM49189M5 20 µg

Ndufc1 (NM_025523) Mouse Recombinant Protein

Sign In for Pricing
View Details
Anti-Mouse CD90 (T24/31) In Vivo Antibody - Low Endotoxin
ICH1064-25mg 25 mg

Anti-Mouse CD90 (T24/31) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details