Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gpatch2l shRNA (UAS) - Lentiviral mouse Gpatch2l shRNA (UAS) (25)
GTR15243329 1 Vial

Lentiviral mouse Gpatch2l shRNA (UAS) - Lentiviral mouse Gpatch2l shRNA (UAS) (25)

Sign In for Pricing
View Details
Donkey Potassium Voltage-Gated Channel Subfamily G Member 1 (KCNG1) ELISA Kit
MBS9931184 Inquire

Donkey Potassium Voltage-Gated Channel Subfamily G Member 1 (KCNG1) ELISA Kit

Sign In for Pricing
View Details
ADAMTS-19 Rabbit Polyclonal Antibody
APRab06600-01 20 µL

ADAMTS-19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS-19 Rabbit Polyclonal Antibody
APRab06600-02 50 µL

ADAMTS-19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS-19 Rabbit Polyclonal Antibody
APRab06600-03 100 µL

ADAMTS-19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS-19 Rabbit Polyclonal Antibody
APRab06600-04 200 µL

ADAMTS-19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details