Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Vacuolating cytotoxin A (VacA) ELISA Kit
NSL0996Bo 96 Tests

Bovine Vacuolating cytotoxin A (VacA) ELISA Kit

Sign In for Pricing
View Details
Plasmid Residual DNA Detection Kit
HBP003309S 30 Tests

Plasmid Residual DNA Detection Kit

Sign In for Pricing
View Details
Activating Molecule In BECN1-Regulated Autophagy Protein 1 (AMBRA1) Antibody
abx448517 100 µg

Activating Molecule In BECN1-Regulated Autophagy Protein 1 (AMBRA1) Antibody

Sign In for Pricing
View Details
ARHGDIB / D4-GDI (1-201, His-tag) Human Protein
AR50295PU-S 10 µg

ARHGDIB / D4-GDI (1-201, His-tag) Human Protein

Sign In for Pricing
View Details
Mouse Autophagy related protein 13, ATG13 ELISA KIT
E2645Mo-01 48 Well

Mouse Autophagy related protein 13, ATG13 ELISA KIT

Sign In for Pricing
View Details
Mouse Autophagy related protein 13, ATG13 ELISA KIT
E2645Mo-02 96 Well

Mouse Autophagy related protein 13, ATG13 ELISA KIT

Sign In for Pricing
View Details