Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMUG1 Antibody
A21586-50UG 50 µg

SMUG1 Antibody

Sign In for Pricing
View Details
TPM3 Antibody, HRP conjugated
A37301-100UG 100 µg

TPM3 Antibody, HRP conjugated

Sign In for Pricing
View Details
CHEK2 (CHK2 Checkpoint Homolog (S. pombe), CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53) (Biotin)
207543-Biotin 100 µL

CHEK2 (CHK2 Checkpoint Homolog (S. pombe), CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53) (Biotin)

Sign In for Pricing
View Details
CD95 (Fas) (MaxLight 550)
MBS6254781-01 0.1 mL

CD95 (Fas) (MaxLight 550)

Sign In for Pricing
View Details
CD95 (Fas) (MaxLight 550)
MBS6254781-02 5x 0.1 mL

CD95 (Fas) (MaxLight 550)

Sign In for Pricing
View Details
MID1 (NM_001098624) Human Tagged ORF Clone
RG213454 10 µg

MID1 (NM_001098624) Human Tagged ORF Clone

Sign In for Pricing
View Details