Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IFN-omega antibody
STJ96780 200 µl

Anti-IFN-omega antibody

Sign In for Pricing
View Details
Porcine Foot and Mouth Disease Virus Antibody IgG, FMDV Ab IgG ELISA KIT
ED0014Po-01 96 Well

Porcine Foot and Mouth Disease Virus Antibody IgG, FMDV Ab IgG ELISA KIT

Sign In for Pricing
View Details
Porcine Foot and Mouth Disease Virus Antibody IgG, FMDV Ab IgG ELISA KIT
ED0014Po-02 5x 96 Tests

Porcine Foot and Mouth Disease Virus Antibody IgG, FMDV Ab IgG ELISA KIT

Sign In for Pricing
View Details
Porcine Foot and Mouth Disease Virus Antibody IgG, FMDV Ab IgG ELISA KIT
ED0014Po-03 10x 96 Tests

Porcine Foot and Mouth Disease Virus Antibody IgG, FMDV Ab IgG ELISA KIT

Sign In for Pricing
View Details
ZNF202 Polyclonal Antibody
E55A04861 100 µg

ZNF202 Polyclonal Antibody

Sign In for Pricing
View Details
Phenobarbital (Phenobarbitone) (APC)
215078-APC 100 µL

Phenobarbital (Phenobarbitone) (APC)

Sign In for Pricing
View Details