Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RACGAP1 Mouse Monoclonal Antibody [Clone 4H8]
E45M20365V-2 50 µL

RACGAP1 Mouse Monoclonal Antibody [Clone 4H8]

Sign In for Pricing
View Details
Human CoQ10 (Coenzyme Q10) ELISA Kit
EK248530 96 Well

Human CoQ10 (Coenzyme Q10) ELISA Kit

Sign In for Pricing
View Details
Txlng (NM_001290777) Mouse Tagged ORF Clone
MR228727 10 µg

Txlng (NM_001290777) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 UPF0253 protein VC_0872 (VC_0872)
MBS1346997-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 UPF0253 protein VC_0872 (VC_0872)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 UPF0253 protein VC_0872 (VC_0872)
MBS1346997-02 0.1 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 UPF0253 protein VC_0872 (VC_0872)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 UPF0253 protein VC_0872 (VC_0872)
MBS1346997-03 0.02 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 UPF0253 protein VC_0872 (VC_0872)

Sign In for Pricing
View Details