Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ULK3 antibody - middle region
MBS3214136-01 0.1 mL

ULK3 antibody - middle region

Sign In for Pricing
View Details
ULK3 antibody - middle region
MBS3214136-02 5x 0.1 mL

ULK3 antibody - middle region

Sign In for Pricing
View Details
Rabbit Monoclonal FDPS Antibody (005) [DyLight 755]
NBP2-90198IR 0.1 mL

Rabbit Monoclonal FDPS Antibody (005) [DyLight 755]

Sign In for Pricing
View Details
Canine Mitochondrial fission 1 protein ELISA Kit
MBS7277706-01 48 Well

Canine Mitochondrial fission 1 protein ELISA Kit

Sign In for Pricing
View Details
Canine Mitochondrial fission 1 protein ELISA Kit
MBS7277706-02 96 Well

Canine Mitochondrial fission 1 protein ELISA Kit

Sign In for Pricing
View Details
Canine Mitochondrial fission 1 protein ELISA Kit
MBS7277706-03 5x 96 Well

Canine Mitochondrial fission 1 protein ELISA Kit

Sign In for Pricing
View Details