Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Angiotensin II Antibody (KAA8) [Alexa Fluor 750] - Chimeric
NBP3-20123AF750 0.1 mL

Rabbit Monoclonal Angiotensin II Antibody (KAA8) [Alexa Fluor 750] - Chimeric

Sign In for Pricing
View Details
Olfr1359 ORF Vector (Mouse) (pORF)
ORF052276 1.0 µg DNA

Olfr1359 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CASP7 ORF Vector (Human) (pORF)
ORF001891 1.0 µg DNA

CASP7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
OR1N1, CT (OR1N1, OR1N3, Olfactory receptor 1N1, Olfactory receptor 1-26, Olfactory receptor 1N3, Olfactory receptor OR9-22) (AP)
MBS6328228-01 0.2 mL

OR1N1, CT (OR1N1, OR1N3, Olfactory receptor 1N1, Olfactory receptor 1-26, Olfactory receptor 1N3, Olfactory receptor OR9-22) (AP)

Sign In for Pricing
View Details
OR1N1, CT (OR1N1, OR1N3, Olfactory receptor 1N1, Olfactory receptor 1-26, Olfactory receptor 1N3, Olfactory receptor OR9-22) (AP)
MBS6328228-02 5x 0.2 mL

OR1N1, CT (OR1N1, OR1N3, Olfactory receptor 1N1, Olfactory receptor 1-26, Olfactory receptor 1N3, Olfactory receptor OR9-22) (AP)

Sign In for Pricing
View Details
Lentiviral mouse Kcnt2 shRNA (UAS) - Lentiviral mouse Kcnt2 shRNA (UAS) plasmid
GTR15270415 1 Vial

Lentiviral mouse Kcnt2 shRNA (UAS) - Lentiviral mouse Kcnt2 shRNA (UAS) plasmid

Sign In for Pricing
View Details