Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEM7 (PLXDC1) Human Gene Knockout Kit (CRISPR)
KN406233 1 Kit

TEM7 (PLXDC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FBXL3 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-8467R-PE-Cy5.5 100 µL

FBXL3 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal DDHD1 Antibody [DyLight 488]
NBP3-05949G 0.1 mL

Rabbit Polyclonal DDHD1 Antibody [DyLight 488]

Sign In for Pricing
View Details
CD24 (NM_001291737) Human Tagged ORF Clone
RC235505 10 µg

CD24 (NM_001291737) Human Tagged ORF Clone

Sign In for Pricing
View Details
Prestained protein marker (2.7-40kDa)
OM750032 250 µL

Prestained protein marker (2.7-40kDa)

Sign In for Pricing
View Details
Human Uncharacterized protein C9orf82, C9orf82 ELISA Kit
MBS9316497-01 48 Well

Human Uncharacterized protein C9orf82, C9orf82 ELISA Kit

Sign In for Pricing
View Details