Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Polyclonal Donkey anti-Mouse IgG (H+L) Secondary Antibody [DyLight 550] (Pre-absorbed)
NBP1-75616 1 mg

Donkey Polyclonal Donkey anti-Mouse IgG (H+L) Secondary Antibody [DyLight 550] (Pre-absorbed)

Sign In for Pricing
View Details
Glycine, Hi-AR™/ACS
GRM199-250G 1 unit

Glycine, Hi-AR™/ACS

Sign In for Pricing
View Details
Lentiviral human BLMH sgRNA gene knockout kit - Lentiviral human BLMH sgRNA gene knockout kit (25)
GTR15357480 1 Vial

Lentiviral human BLMH sgRNA gene knockout kit - Lentiviral human BLMH sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Fumarate reductase subunit D (frdD), partial
MBS7063363 Inquire

Recombinant Mycobacterium bovis Fumarate reductase subunit D (frdD), partial

Sign In for Pricing
View Details
MARCH3 Over-expression Lysate Product
GWB-B2ADCC 0.1 mg

MARCH3 Over-expression Lysate Product

Sign In for Pricing
View Details
SCYL1BP1 (GORAB) Mouse Monoclonal Antibody [Clone ID: OTI1E3]
CF505075 100 µg

SCYL1BP1 (GORAB) Mouse Monoclonal Antibody [Clone ID: OTI1E3]

Sign In for Pricing
View Details