Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Formula

12759 (Gene_ID) Q06890 (E22-E448) (Accession)

Molecular Weight

Approximately 29-44 & 60-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-conjugated Anti-ANPEP antibody (26H2), IgG1 Chimeric mAb
MBS1882370-01 100 Tests

PE-conjugated Anti-ANPEP antibody (26H2), IgG1 Chimeric mAb

Sign In for Pricing
View Details
PE-conjugated Anti-ANPEP antibody (26H2), IgG1 Chimeric mAb
MBS1882370-02 5x 100 Tests

PE-conjugated Anti-ANPEP antibody (26H2), IgG1 Chimeric mAb

Sign In for Pricing
View Details
TUT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV701969 1.0 µg DNA

TUT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
PPIL4, NT (PPIL4, Peptidyl-prolyl cis-trans isomerase-like 4, Cyclophilin-like protein PPIL4, Rotamase PPIL4) (Azide free) (HRP) discontinued
040319-HRP 200 µL

PPIL4, NT (PPIL4, Peptidyl-prolyl cis-trans isomerase-like 4, Cyclophilin-like protein PPIL4, Rotamase PPIL4) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Ganoderenic acid E
TBW00088 10mg

Ganoderenic acid E

Sign In for Pricing
View Details
MAP3K13 Antibody (FITC)
abx317003-01 20 µg

MAP3K13 Antibody (FITC)

Sign In for Pricing
View Details