Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC14A, Mouse (HEK293, His)

CLEC14A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CLEC14A protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

CLEC14A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec14a-protein-mouse-hek293-his.html

Purity

96.00

Smiles

EHPTADRAACSASGACYSLHHATFKRRAAEEACSLRGGTLSTVHSGSEFQAVLLLLRAGPGPGGGSKDLLFWVALERSISQCTQEKEPLRGFSWLHPDSEDSEDSPLPWVEEPQRSCTVRKCAALQATRGVEPAGWKEMRCHLRTDGYLCKYQFEVLCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPGDLSVSSTCIQEETSAHWDGLFPGTVLCPCSGRYLLAGKCVELPDCLDHLGDFTCECAVGFELGKDGRSCETKVEEQLTLEGTKLPTRNVTATPAGAVTNRTWPGQVYDKPGEMPQVTEILQWGTQSTLPTIQKTPQTKPKVTGTPSGSVVLNYTSSPPVSLTFDTSST

Molecular Formula

66864 (Gene_ID) Q8VCP9 (E22-T386) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-100 1x 100 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details