Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Epiregulin, Human

Epiregulin Protein, Human is a growth regulator and a member of the epidermal growth factor (EGF) family. Epiregulin is a tumor growth-inhibitory factor inducing morphological changes in human epidermoid carcinoma HeLa cells.

Product Specifications

Product Name Alternative

Epiregulin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epiregulin-protein-human.html

Purity

98.0

Smiles

VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL

Molecular Formula

2069 (Gene_ID) O14944 (V60-L108) (Accession)

Molecular Weight

Approximately 5.6 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Toyoda H, et al. Distribution of mRNA for human epiregulin, a differentially expressed member of the epidermal growth factor family. Biochem J. 1997 Aug 15;326 (Pt 1) :69-75.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT-1 (MT1/410), CF640R conjugate, 0.1mg/mL
BNC400410-100 1x 100 µL

MALT-1 (MT1/410), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Ethylphenylhydrazine hydrochloride
TRC-E926055-250MG 250 mg

2-Ethylphenylhydrazine hydrochloride

Sign In for Pricing
View Details
Propargylamine, Hydrochloride
TRC-P762525-2.5G 2.5 g

Propargylamine, Hydrochloride

Sign In for Pricing
View Details
BCL2L15 (NM_001010922) Human Over-expression Lysate
LC423230 20 µg

BCL2L15 (NM_001010922) Human Over-expression Lysate

Sign In for Pricing
View Details
GBP3 Antibody
8C16080-AAT 50 µg

GBP3 Antibody

Sign In for Pricing
View Details
RFP, AlpSdAbs® VHH
HA710075 100 µg

RFP, AlpSdAbs® VHH

Sign In for Pricing
View Details