Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Epiregulin, Human

Epiregulin Protein, Human is a growth regulator and a member of the epidermal growth factor (EGF) family. Epiregulin is a tumor growth-inhibitory factor inducing morphological changes in human epidermoid carcinoma HeLa cells.

Product Specifications

Product Name Alternative

Epiregulin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epiregulin-protein-human.html

Purity

98.0

Smiles

VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL

Molecular Formula

2069 (Gene_ID) O14944 (V60-L108) (Accession)

Molecular Weight

Approximately 5.6 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Toyoda H, et al. Distribution of mRNA for human epiregulin, a differentially expressed member of the epidermal growth factor family. Biochem J. 1997 Aug 15;326 (Pt 1) :69-75.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASZ1 Polyclonal Antibody
E-AB-66285-01 60 µL

ASZ1 Polyclonal Antibody

Sign In for Pricing
View Details
ASZ1 Polyclonal Antibody
E-AB-66285-02 120 µL

ASZ1 Polyclonal Antibody

Sign In for Pricing
View Details
ASZ1 Polyclonal Antibody
E-AB-66285-03 200 µL

ASZ1 Polyclonal Antibody

Sign In for Pricing
View Details
DAXX (NM_001350) Human Recombinant Protein
TP319497 20 µg

DAXX (NM_001350) Human Recombinant Protein

Sign In for Pricing
View Details
HP1 gamma (CBX3) Mouse Monoclonal Antibody [Clone ID: 9E5-1E3-3A8]
TA383890 100 µL

HP1 gamma (CBX3) Mouse Monoclonal Antibody [Clone ID: 9E5-1E3-3A8]

Sign In for Pricing
View Details
Fibulin 5 (FBLN5) Mouse Monoclonal Antibody [Clone ID: 1G6A4]
AM06223SU-N 100 µL

Fibulin 5 (FBLN5) Mouse Monoclonal Antibody [Clone ID: 1G6A4]

Sign In for Pricing
View Details