Epiregulin, Human
Epiregulin Protein, Human is a growth regulator and a member of the epidermal growth factor (EGF) family. Epiregulin is a tumor growth-inhibitory factor inducing morphological changes in human epidermoid carcinoma HeLa cells.
Product Specifications
Product Name Alternative
Epiregulin Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/epiregulin-protein-human.html
Purity
98.0
Smiles
VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
Molecular Formula
2069 (Gene_ID) O14944 (V60-L108) (Accession)
Molecular Weight
Approximately 5.6 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Toyoda H, et al. Distribution of mRNA for human epiregulin, a differentially expressed member of the epidermal growth factor family. Biochem J. 1997 Aug 15;326 (Pt 1) :69-75.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
14026111 3x 1.0 µg
C18orf20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details TL506680V 500 µL Each
Pex6 Mouse shRNA Lentiviral Particle (Locus ID 224824)
Sign In for Pricing
View Details MBS6344339-01 0.2 mL
RTL1, CT (MAR1, MART1, PEG11, Retrotransposon-like protein 1, Mammalian retrotransposon derived protein 1, Paternally expressed gene 11 protein, Retrotransposon-derived protein PEG11) (Biotin)
Sign In for Pricing
View Details MBS6344339-02 5x 0.2 mL
RTL1, CT (MAR1, MART1, PEG11, Retrotransposon-like protein 1, Mammalian retrotransposon derived protein 1, Paternally expressed gene 11 protein, Retrotransposon-derived protein PEG11) (Biotin)
Sign In for Pricing
View Details