Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TL1A/TNFSF15, Mouse

The TL1A protein (VEGI protein), belongs to the tumor necrosis factor (TNF) family and is a receptor for TNFRSF25 and TNFRSF6B. TL1A is involved in the activation of NF-κB and C-Jun pathways, which can be used as a regulator of mucosal immunity and participate in the immune pathway of inflammatory bowel disease (IBD) pathogenesis[1][2]. TL1A originates from endothelial cells and inhibits the proliferation of breast cancer, epithelial and myeloid tumor cells[3]. The mouse TL1A protein has a transmembrane domain (40-60 a.a.) that can be cleaved into membrane-type and soluble peptide fragments. TL1A/TNFSF15 Protein, Mouse is the extracullar part of TL1A protein (I76-L252), produced in E.coli with tag free.

Product Specifications

Product Name Alternative

TL1A/TNFSF15 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tl1a-tnfsf15-protein-mouse.html

Purity

95.0

Smiles

ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

Molecular Formula

326623 (Gene_ID) B2RR33/AAV33431.1 (I76-L252) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Furfaro F, et al. TL1A: A New Potential Target in the Treatment of Inflammatory Bowel Disease. Curr Drug Targets. 2021;22 (7) :760-769.|[2]Migone TS, et al. TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator. Immunity. 2002 Mar;16 (3) :479-92.|[3]Haridas V, et al. VEGI, a new member of the TNF family activates nuclear factor-kappa B and c-Jun N-terminal kinase and modulates cell growth. Oncogene. 1999 Nov 11;18 (47) :6496-504.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Hydroxide 10M (10N) Solution
2424K 00500 500 mL

Sodium Hydroxide 10M (10N) Solution

Sign In for Pricing
View Details
TTK Rabbit Polyclonal Antibody
HA500249 100 µL

TTK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Regulation upon Activation Normal T cell Express Sequence/CCL5
P1461-.5 500 µg

Recombinant Human Regulation upon Activation Normal T cell Express Sequence/CCL5

Sign In for Pricing
View Details
Brd3 ORF Vector (Mouse) (pORF)
ORF039958 1.0 µg DNA

Brd3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human SNRPB2 activation kit by CRISPRa
GA104542 1 Kit

Human SNRPB2 activation kit by CRISPRa

Sign In for Pricing
View Details
HCV, NS3 (Nonstructural Protein 3)
MBS6005470-01 0.1 mg

HCV, NS3 (Nonstructural Protein 3)

Sign In for Pricing
View Details